Lineage for d1tqye1 (1tqy E:3-257)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2523779Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2523780Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA [110752] (1 species)
  7. 2523781Species Streptomyces coelicolor [TaxId:1902] [110753] (1 PDB entry)
    Uniprot Q02059
  8. 2523786Domain d1tqye1: 1tqy E:3-257 [107253]
    Other proteins in same PDB: d1tqyb1, d1tqyb2, d1tqyd1, d1tqyd2, d1tqyf1, d1tqyf2, d1tqyh1, d1tqyh2
    complexed with ace, mg, na

Details for d1tqye1

PDB Entry: 1tqy (more details), 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor
PDB Compounds: (E:) Beta-Ketoacyl synthase/Acyl transferase

SCOPe Domain Sequences for d1tqye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqye1 c.95.1.1 (E:3-257) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]}
rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa
mfvledydsalarga

SCOPe Domain Coordinates for d1tqye1:

Click to download the PDB-style file with coordinates for d1tqye1.
(The format of our PDB-style files is described here.)

Timeline for d1tqye1: