Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (10 proteins) |
Protein Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB [110754] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [110755] (1 PDB entry) Uniprot Q02062 |
Domain d1tqyd2: 1tqy D:247-403 [107252] Other proteins in same PDB: d1tqya1, d1tqya2, d1tqyc1, d1tqyc2, d1tqye1, d1tqye2, d1tqyg1, d1tqyg2 complexed with ace, mg, na |
PDB Entry: 1tqy (more details), 2 Å
SCOPe Domain Sequences for d1tqyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqyd2 c.95.1.1 (D:247-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} rhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagvpelda aearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvtsvpre ygidlvlgeprstaprtalvlargrwgfnsaavlrrf
Timeline for d1tqyd2: