Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein L-Ala-D/L-Glu epimerase [69711] (2 species) |
Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries) Uniprot O34508 |
Domain d1tkkf2: 1tkk F:2-125 [107100] Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1 complexed with ala, mg |
PDB Entry: 1tkk (more details), 2.1 Å
SCOPe Domain Sequences for d1tkkf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkkf2 d.54.1.1 (F:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq mlgg
Timeline for d1tkkf2: