Lineage for d1ti4k1 (1ti4 K:729-875)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070519Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2070582Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2070613Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 2070682Protein Transhydroxylase alpha subunit, AthL [110250] (1 species)
  7. 2070683Species Pelobacter acidigallici [TaxId:35816] [110251] (6 PDB entries)
    Uniprot P80563
  8. 2070701Domain d1ti4k1: 1ti4 K:729-875 [106970]
    Other proteins in same PDB: d1ti4a2, d1ti4b1, d1ti4b2, d1ti4c2, d1ti4d1, d1ti4d2, d1ti4e2, d1ti4f1, d1ti4f2, d1ti4g2, d1ti4h1, d1ti4h2, d1ti4i2, d1ti4j1, d1ti4j2, d1ti4k2, d1ti4l1, d1ti4l2
    complexed with 4mo, ca, mgd, pyg, sf4
    complexed with 4mo, ca, mgd, pyg, sf4

Details for d1ti4k1

PDB Entry: 1ti4 (more details), 2.2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with pyrogallol
PDB Compounds: (K:) Pyrogallol hydroxytransferase large subunit

SCOPe Domain Sequences for d1ti4k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ti4k1 b.52.2.2 (K:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]}
kyplgmlsphprfsmhtmgdgknsymnyikdhrvevdgykywimrvnsidaeargikngd
lirayndrgsvilaaqvteclqpgtvhsyescavydplgtagksadrggciniltpdryi
skyacgmanntalveiekwdgdkyeiy

SCOPe Domain Coordinates for d1ti4k1:

Click to download the PDB-style file with coordinates for d1ti4k1.
(The format of our PDB-style files is described here.)

Timeline for d1ti4k1: