Lineage for d1te2b_ (1te2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2526948Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2527035Protein Phosphatase YniC [110504] (1 species)
  7. 2527036Species Escherichia coli [TaxId:562] [110505] (1 PDB entry)
    Uniprot P77247
  8. 2527038Domain d1te2b_: 1te2 B: [106793]
    Structural genomics target
    complexed with ca, pga

Details for d1te2b_

PDB Entry: 1te2 (more details), 1.76 Å

PDB Description: putative phosphatase ynic from escherichia coli k12
PDB Compounds: (B:) 2-deoxyglucose-6-P phosphatase

SCOPe Domain Sequences for d1te2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1te2b_ c.108.1.6 (B:) Phosphatase YniC {Escherichia coli [TaxId: 562]}
rqilaaifdmdgllidseplwdraeldvmaslgvdisrrnelpdtlglridmvvdlwyar
qpwngpsrqevverviaraislveetrpllpgvreavalckeqgllvglasasplhmlek
vltmfdlrdsfdalasaeklpyskphpqvyldcaaklgvdpltcvaledsvngmiaskaa
rmrsivvpapeaqndprfvlanvklsslteltakdllg

SCOPe Domain Coordinates for d1te2b_:

Click to download the PDB-style file with coordinates for d1te2b_.
(The format of our PDB-style files is described here.)

Timeline for d1te2b_: