SCOP 1.69: Domain d1te2b_: 1te2 B:

Lineage for d1te2b_ (1te2 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (16 families)
   contains an insert alpha+beta subdomain; similar overall fold to the Cof family
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (2 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Phosphatase YniC [110504] (1 species)

7. Species Escherichia coli [TaxId:562] [110505] (1 PDB entry)

8. Domain d1te2b_: 1te2 B: [106793]
   Structural genomics target

Details for d1te2b_

PDB Entry: 1te2, 1.76 Å

PDB Description: putative phosphatase ynic from escherichia coli k12

SCOP Domain Sequences for d1te2b_:

Sequence; same for both SEQRES and ATOM records:

>d1te2b_ c.108.1.6 (B:) Phosphatase YniC {Escherichia coli}
rqilaaifdmdgllidseplwdraeldvmaslgvdisrrnelpdtlglridmvvdlwyar
qpwngpsrqevverviaraislveetrpllpgvreavalckeqgllvglasasplhmlek
vltmfdlrdsfdalasaeklpyskphpqvyldcaaklgvdpltcvaledsvngmiaskaa
rmrsivvpapeaqndprfvlanvklsslteltakdllg

Timeline for d1te2b_:

• d1te2b_ is new in SCOP 1.69
  
• d1te2b_ appears in SCOP 1.71
  
• d1te2b_ appears in the current release, SCOPe 2.08