Lineage for d1ta3a_ (1ta3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1819776Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1819998Protein Xylanase inhibitor protein I, XIP-I [89478] (1 species)
  7. 1819999Species Wheat (Triticum aestivum) [TaxId:4565] [89479] (3 PDB entries)
    Uniprot Q8L5C6
  8. 1820000Domain d1ta3a_: 1ta3 A: [106731]
    Other proteins in same PDB: d1ta3b_
    complexed with edo, nag

Details for d1ta3a_

PDB Entry: 1ta3 (more details), 1.7 Å

PDB Description: crystal structure of xylanase (gh10) in complex with inhibitor (xip)
PDB Compounds: (A:) Xylanase Inhibitor Protein I

SCOPe Domain Sequences for d1ta3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]}
aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
apvaqkkdnyggimlwdryfdkqtnysslikyya

SCOPe Domain Coordinates for d1ta3a_:

Click to download the PDB-style file with coordinates for d1ta3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ta3a_: