Class b: All beta proteins [48724] (176 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) |
Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins) |
Protein Galactose oxidase, central domain [50967] (3 species) N-terminal domain is a jelly-roll sandwich C-terminal domain is Immunoglobulin-like |
Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries) Uniprot Q01745 42-680 |
Domain d1t2xa3: 1t2x A:151-537 [106294] Other proteins in same PDB: d1t2xa1, d1t2xa2 complexed with act, cu, na; mutant |
PDB Entry: 1t2x (more details), 2.3 Å
SCOPe Domain Sequences for d1t2xa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2xa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]} ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamsgnavmyd avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng ggglcgdcttnhfdaqiftpnylynsn
Timeline for d1t2xa3: