SCOPe 2.05: Domain d1t2xa3: 1t2x A:151-537

Lineage for d1t2xa3 (1t2x A:151-537)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
   Uniprot Q01745 42-680

8. Domain d1t2xa3: 1t2x A:151-537 [106294]
   Other proteins in same PDB: d1t2xa1, d1t2xa2
   complexed with act, cu, na; mutant

Details for d1t2xa3

PDB Entry: 1t2x, 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1t2xa3:

Sequence; same for both SEQRES and ATOM records:

>d1t2xa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamsgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d1t2xa3:

• d1t2xa3 first appeared in SCOP 1.69
  
• d1t2xa3 appears in SCOPe 2.04
  
• d1t2xa3 appears in SCOPe 2.06
  
• d1t2xa3 appears in the current release, SCOPe 2.08