SCOPe 2.08: Domain d1szpa1: 1szp A:81-144

Lineage for d1szpa1 (1szp A:81-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109871] (2 PDB entries)
   Uniprot P25454 81-395

8. Domain d1szpa1: 1szp A:81-144 [106176]
   Other proteins in same PDB: d1szpa2, d1szpb2, d1szpc2, d1szpd2, d1szpe2, d1szpf2
   complexed with so4

Details for d1szpa1

PDB Entry: 1szp, 3.25 Å

PDB Description: a crystal structure of the rad51 filament

PDB Compounds: (A:) DNA repair protein rad51

SCOPe Domain Sequences for d1szpa1:

Sequence; same for both SEQRES and ATOM records:

>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlv
pmgf

Timeline for d1szpa1:

• d1szpa1 first appeared in SCOP 1.69
  
• d1szpa1 appears in SCOPe 2.07