Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Probable GTPase EngB [89667] (2 species) |
Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries) Uniprot P38424 |
Domain d1sulb_: 1sul B: [106024] |
PDB Entry: 1sul (more details), 2 Å
SCOPe Domain Sequences for d1sulb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sulb_ c.37.1.8 (B:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk gkdeawgaikkminr
Timeline for d1sulb_: