Lineage for d1shqa1 (1shq A:4-476)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905606Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2905607Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2905608Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2905609Protein Alkaline phosphatase [53651] (4 species)
  7. 2905708Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)
    Uniprot Q9BHT8 # fragment
  8. 2905711Domain d1shqa1: 1shq A:4-476 [105560]
    Other proteins in same PDB: d1shqa2, d1shqb2
    complexed with mg, nag, so4, zn

Details for d1shqa1

PDB Entry: 1shq (more details), 2 Å

PDB Description: crystal structure of shrimp alkaline phosphatase with magnesium in m3
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1shqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shqa1 c.76.1.1 (A:4-476) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]}
kaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfereki
sweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqldesl
ftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeicddi
aeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasqgat
asyvwnrddllavdirntdylmglfsythldtvltrdaemdptlpemtkvaiemltkden
gffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhghtlti
tgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfryas
aapkhsvthdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

SCOPe Domain Coordinates for d1shqa1:

Click to download the PDB-style file with coordinates for d1shqa1.
(The format of our PDB-style files is described here.)

Timeline for d1shqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1shqa2