Lineage for d1s9aa_ (1s9a A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2042624Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
    similar overall structure to Catechol 1,2-dioxygenase
  7. 2042625Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries)
    Uniprot O67987
  8. 2042628Domain d1s9aa_: 1s9a A: [105379]
    complexed with bez, fe, hgp, tam

Details for d1s9aa_

PDB Entry: 1s9a (more details), 2.47 Å

PDB Description: crystal structure of 4-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp
PDB Compounds: (A:) Chlorocatechol 1,2-dioxygenase

SCOPe Domain Sequences for d1s9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

SCOPe Domain Coordinates for d1s9aa_:

Click to download the PDB-style file with coordinates for d1s9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1s9aa_: