Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein Neurolysin (endopeptidase 24.16, thimet oligopeptidase) [55506] (2 species) M3 family member; the thermolysin-like catalytic domain consists of residues 352-674 |
Species Human (Homo sapiens) [TaxId:9606] [111081] (2 PDB entries) Uniprot P52888 |
Domain d1s4bp_: 1s4b P: [105252] complexed with zn |
PDB Entry: 1s4b (more details), 2 Å
SCOPe Domain Sequences for d1s4bp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]} lrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevtytvqrnild fpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslrpeaaryle rliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqelgglpedf lnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensailkelvtlr aqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravilelkraecer rglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqellglafhh eegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgclrqdgsrqi aiaamvanftkptadapsllqhdevetyfhefghvmhqlcsqaefamfsgthverdfvea psqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqa lhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylwsevysmdmf htrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllskgl
Timeline for d1s4bp_: