SCOP 1.75: Domain d1rmpa_: 1rmp A:

Lineage for d1rmpa_ (1rmp A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (5 proteins)

6. Protein Green fluorescent protein, GFP [54513] (2 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (53 PDB entries)
   Uniprot P42212

8. Domain d1rmpa_: 1rmp A: [105017]
   complexed with 23s, cro

Details for d1rmpa_

PDB Entry: 1rmp, 3 Å

PDB Description: Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code

PDB Compounds: (A:) SIGF1-GFP fusion protein

SCOP Domain Sequences for d1rmpa_:

Sequence; same for both SEQRES and ATOM records:

>d1rmpa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
lgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

Timeline for d1rmpa_:

• d1rmpa_ first appeared in SCOP 1.69
  
• d1rmpa_ appears in SCOP 1.73
  
• d1rmpa_ appears in SCOPe 2.01
  
• d1rmpa_ appears in the current release, SCOPe 2.08