Lineage for d1rgra_ (1rgr A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786103Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 1786106Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (8 PDB entries)
    Uniprot P31016 62-154
  8. 1786111Domain d1rgra_: 1rgr A: [104931]
    complexed with bal

Details for d1rgra_

PDB Entry: 1rgr (more details)

PDB Description: cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability
PDB Compounds: (A:) Presynaptic density protein 95

SCOPe Domain Sequences for d1rgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn
evdvrevthsaavealkeagsivrlyvmrrkpp

SCOPe Domain Coordinates for d1rgra_:

Click to download the PDB-style file with coordinates for d1rgra_.
(The format of our PDB-style files is described here.)

Timeline for d1rgra_: