Lineage for d1ppjf_ (1ppj F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699236Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699237Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1699238Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1699239Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1699250Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
    Uniprot P00129
  8. 1699251Domain d1ppjf_: 1ppj F: [104262]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_
    complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppjf_

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d1ppjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
qqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1ppjf_:

Click to download the PDB-style file with coordinates for d1ppjf_.
(The format of our PDB-style files is described here.)

Timeline for d1ppjf_: