![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries) Uniprot P00157 |
![]() | Domain d1ppjc2: 1ppj C:15-260 [104257] Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_ complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma |
PDB Entry: 1ppj (more details), 2.1 Å
SCOPe Domain Sequences for d1ppjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppjc2 f.21.1.2 (C:15-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd nytpan
Timeline for d1ppjc2:
![]() Domains from other chains: (mouse over for more information) d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_ |