Lineage for d1pg8a_ (1pg8 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1000625Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1000626Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1001037Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1001162Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 1001170Species Pseudomonas putida [TaxId:303] [75271] (4 PDB entries)
    Uniprot P13254
  8. 1001183Domain d1pg8a_: 1pg8 A: [104150]
    complexed with peg, plp, so4

Details for d1pg8a_

PDB Entry: 1pg8 (more details), 2.68 Å

PDB Description: Crystal Structure of L-methionine alpha-, gamma-lyase
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d1pg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg8a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d1pg8a_:

Click to download the PDB-style file with coordinates for d1pg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1pg8a_: