Class a: All alpha proteins [46456] (289 folds) |
Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) |
Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries) |
Domain d1peqa1: 1peq A:13-174 [104131] Other proteins in same PDB: d1peqa2 complexed with mg, ttp |
PDB Entry: 1peq (more details), 2.8 Å
SCOPe Domain Sequences for d1peqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1peqa1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge
Timeline for d1peqa1: