SCOPe 2.01: Domain d1okja2: 1okj A:107-216

Lineage for d1okja2 (1okj A:107-216)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.9: YeaZ-like [110633] (2 proteins)
   Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity

6. Protein Hypothetical protein YeaZ [110634] (1 species)

7. Species Escherichia coli [TaxId:562] [110635] (1 PDB entry)
   Uniprot P76256

8. Domain d1okja2: 1okj A:107-216 [103999]
   complexed with gd3

Details for d1okja2

PDB Entry: 1okj, 2.28 Å

PDB Description: crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex "DOTMA"

PDB Compounds: (A:) hypothetical protease yeaz

SCOPe Domain Sequences for d1okja2:

Sequence; same for both SEQRES and ATOM records:

>d1okja2 c.55.1.9 (A:107-216) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]}
atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw
qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvy

Timeline for d1okja2:

• d1okja2 first appeared in SCOP 1.69
  
• d1okja2 appears in SCOP 1.75
  
• d1okja2 appears in SCOPe 2.02
  
• d1okja2 appears in the current release, SCOPe 2.08