SCOPe 2.05: Domain d1vj0a1: 1vj0 A:2-155,A:338-367

Lineage for d1vj0a1 (1vj0 A:2-155,A:338-367)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Hypothetical protein TM0436 [101704] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101705] (1 PDB entry)

8. Domain d1vj0a1: 1vj0 A:2-155,A:338-367 [100786]
   Other proteins in same PDB: d1vj0a2, d1vj0b2, d1vj0c2, d1vj0d2
   structural genomics
   complexed with unl, zn

Details for d1vj0a1

PDB Entry: 1vj0, 2 Å

PDB Description: crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution

PDB Compounds: (A:) alcohol dehydrogenase, zinc-containing

SCOPe Domain Sequences for d1vj0a1:

Sequence; same for both SEQRES and ATOM records:

>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}
mglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpi
ilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvy
ginrgcseyphlrgcysshivldpetdvlkvsekXithrlplkeankalelmesrealkv
ilype

Timeline for d1vj0a1:

• d1vj0a1 first appeared in SCOP 1.67
  
• d1vj0a1 appears in SCOPe 2.04
  
• d1vj0a1 appears in SCOPe 2.06
  
• d1vj0a1 appears in the current release, SCOPe 2.08