SCOPe 2.08: Domain d1vcra_: 1vcr A:

Lineage for d1vcra_ (1vcr A:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.5: Photosystems [58155] (1 superfamily)

4. Superfamily i.5.1: Photosystems [58156] (1 family)

5. Family i.5.1.1: Photosystems [58157] (5 proteins)
   not a true family

6. Protein Chlorophyll a-b binding protein [103669] (1 species)
   light-harvesting chlorophyll a/b protein complex with an icosahedral assembly

7. Species Pea (Pisum sativum) [TaxId:3888] [103670] (1 PDB entry)
   a higher resolution structure of a homologous protein is also available, PDB entry 1RWT

8. Domain d1vcra_: 1vcr A: [100560]
   complexed with chl, cla

Details for d1vcra_

PDB Entry: 1vcr, 9.5 Å

PDB Description: an icosahedral assembly of light-harvesting chlorophyll a/b protein complex from pea thylakoid membranes

PDB Compounds: (A:) chlorophyll a-b binding protein ab80

SCOPe Domain Sequences for d1vcra_:

Sequence, based on SEQRES records:

>d1vcra_ i.5.1.1 (A:) Chlorophyll a-b binding protein {Pea (Pisum sativum) [TaxId: 3888]}
petfsknrelevihsrwamlgalgcvfpellsrngvkfgeavwfkagsqifseggldylg
npslvhaqsilaiwatqvilmgavegyriaggplgevvdplypggsfdplgladdpeafa
elkvkelkngrlamfsmfgffvqaivtgkgplenladhla

Sequence, based on observed residues (ATOM records):

>d1vcra_ i.5.1.1 (A:) Chlorophyll a-b binding protein {Pea (Pisum sativum) [TaxId: 3888]}
petfsknrelevihsrwamlgalgcvfpellsrngsilaiwatqvilmgavegyripeaf
aelkvkelkngrlamfsmfgffvqaivtgkgplenladhla

Timeline for d1vcra_:

• d1vcra_ first appeared in SCOP 1.67
  
• d1vcra_ appears in SCOPe 2.07