Lineage for d1v55u_ (1v55 U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714739Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714740Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2714741Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2714742Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2714743Species Cow (Bos taurus) [TaxId:9913] [47697] (33 PDB entries)
  8. 2714751Domain d1v55u_: 1v55 U: [100371]
    Other proteins in same PDB: d1v55a_, d1v55b1, d1v55b2, d1v55c_, d1v55d_, d1v55e_, d1v55f_, d1v55g_, d1v55i_, d1v55j_, d1v55k_, d1v55l_, d1v55m_, d1v55n_, d1v55o1, d1v55o2, d1v55p_, d1v55q_, d1v55r_, d1v55s_, d1v55t_, d1v55v_, d1v55w_, d1v55x_, d1v55y_, d1v55z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v55u_

PDB Entry: 1v55 (more details), 1.9 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully reduced state
PDB Compounds: (U:) Cytochrome c oxidase polypeptide VIb

SCOPe Domain Sequences for d1v55u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v55u_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d1v55u_:

Click to download the PDB-style file with coordinates for d1v55u_.
(The format of our PDB-style files is described here.)

Timeline for d1v55u_: