Lineage for d1v54s_ (1v54 S:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587816Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 protein domains)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2587817Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2587818Species Cow (Bos taurus) [TaxId:9913] [57820] (35 PDB entries)
  8. 2587824Domain d1v54s_: 1v54 S: [100341]
    Other proteins in same PDB: d1v54a_, d1v54b1, d1v54b2, d1v54c_, d1v54d_, d1v54e_, d1v54g_, d1v54h_, d1v54i_, d1v54j_, d1v54k_, d1v54l_, d1v54m_, d1v54n_, d1v54o1, d1v54o2, d1v54p_, d1v54q_, d1v54r_, d1v54t_, d1v54u_, d1v54v_, d1v54w_, d1v54x_, d1v54y_, d1v54z_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d1v54s_

PDB Entry: 1v54 (more details), 1.8 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (S:) Cytochrome c oxidase polypeptide Vb

SCOPe Domain Sequences for d1v54s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v54s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d1v54s_:

Click to download the PDB-style file with coordinates for d1v54s_.
(The format of our PDB-style files is described here.)

Timeline for d1v54s_: