Lineage for d1uuqa_ (1uuq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819190Protein Exomannosidase [102068] (1 species)
    mannosyl-oligosaccharide glucosidase
  7. 1819191Species Cellvibrio mixtus [TaxId:39650] [102069] (2 PDB entries)
    Uniprot Q6QT42 46-455
  8. 1819192Domain d1uuqa_: 1uuq A: [100015]
    complexed with gol, so4

Details for d1uuqa_

PDB Entry: 1uuq (more details), 1.5 Å

PDB Description: exo-mannosidase from cellvibrio mixtus
PDB Compounds: (A:) mannosyl-oligosaccharide glucosidase

SCOPe Domain Sequences for d1uuqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]}
ehfvrvngghfelqgkpyvitgvnmwyaaylgapnevgdrdrlakeldnlkaigvnnlrv
lavsekseinsavkpavtngfgnydetllqgldyllvelakrdmtvvlyfnnfwqwsggm
tqymawiegepvqdpnvtneweafmaksasfyrsekaqqeyrktlekiitrvnsingkay
vddatimswqlaneprpgnsqttaeekqiyidwvhaaaayiktldahhlvssgsegemgs
vndmqvfidahatpdidyltyhmwirnwswfdktkpaetwpsawekaqnymrahidvakq
lnkplvleefgldrdmgsyamdstteyrdnyfrgvfelmlasleqgepsagyniwawngy
grttranywwqegddfmgdppqeeqgmygvfdtdtstiaimkefnarfqp

SCOPe Domain Coordinates for d1uuqa_:

Click to download the PDB-style file with coordinates for d1uuqa_.
(The format of our PDB-style files is described here.)

Timeline for d1uuqa_: