Lineage for d5pepa_ (5pep A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2410318Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2411615Protein Pepsin(ogen) [50658] (4 species)
  7. 2411628Species Pig (Sus scrofa) [TaxId:9823] [50659] (12 PDB entries)
  8. 2411639Domain d5pepa_: 5pep A: [26845]

Details for d5pepa_

PDB Entry: 5pep (more details), 2.34 Å

PDB Description: x-ray analyses of aspartic proteases. ii. three-dimensional structure of the hexagonal crystal form of porcine pepsin at 2.3 angstroms resolution
PDB Compounds: (A:) pepsin

SCOPe Domain Sequences for d5pepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pepa_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssiaslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

SCOPe Domain Coordinates for d5pepa_:

Click to download the PDB-style file with coordinates for d5pepa_.
(The format of our PDB-style files is described here.)

Timeline for d5pepa_: