Lineage for d5lsda_ (5lsd A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638544Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2638545Protein beta-Nerve growth factor [57525] (2 species)
  7. 2638558Species Mouse (Mus musculus) [TaxId:10090] [57526] (4 PDB entries)
  8. 2638565Domain d5lsda_: 5lsd A: [336500]
    automated match to d1wwww_

Details for d5lsda_

PDB Entry: 5lsd (more details)

PDB Description: recombinant mouse nerve growth factor
PDB Compounds: (A:) Beta-nerve growth factor

SCOPe Domain Sequences for d5lsda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lsda_ g.17.1.3 (A:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

SCOPe Domain Coordinates for d5lsda_:

Click to download the PDB-style file with coordinates for d5lsda_.
(The format of our PDB-style files is described here.)

Timeline for d5lsda_:

2638565
d5lsda_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5lsdb_