PDB entry 5lsd

View 5lsd on RCSB PDB site
Description: recombinant mouse Nerve Growth Factor
Class: cell cycle
Keywords: NGF, homodimer, cystin-knot, dimerfit_1, cell cycle
Deposited on 2016-08-25, released 2017-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lsda_
  • Chain 'B':
    Compound: Beta-nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Ngf, Ngfb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5lsdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lsdA (A:)
ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5lsdB (B:)
ssthpvfhmgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcra
snpvesgcrgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr