Lineage for d5dgxa_ (5dgx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871953Species Francisella tularensis [TaxId:393115] [276956] (1 PDB entry)
  8. 2871954Domain d5dgxa_: 5dgx A: [276957]
    automated match to d2ixfd_
    complexed with adp

Details for d5dgxa_

PDB Entry: 5dgx (more details), 1.73 Å

PDB Description: 1.73 angstrom resolution crystal structure of the abc-atpase domain (residues 357-609) of lipid a transport protein (msba) from francisella tularensis subsp. tularensis schu s4 in complex with adp
PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d5dgxa_:

Sequence, based on SEQRES records: (download)

>d5dgxa_ c.37.1.0 (A:) automated matches {Francisella tularensis [TaxId: 393115]}
ketgskelakvdgnvtikdlsfafgehkvlsgvsvdikagqtvafvgksgsgkttltsii
srfytqhegeilldgvdtreltlenlrshlsivsqnvhlfddtvynniafglsrevseee
vidalkranayefvqelsdgintnignngsklsggqrqrisiarallknapvlifdeats
aldneservvqqalesltkscttiviahrlstvenadkivvmdggrvvesgkhqelleqg
glytrlyqsglq

Sequence, based on observed residues (ATOM records): (download)

>d5dgxa_ c.37.1.0 (A:) automated matches {Francisella tularensis [TaxId: 393115]}
ketgskelakvdgnvtikdlsfafgehkvlsgvsvdikagqtvafvgksgsgkttltsii
srfytqhegeilldgvdtreltlenlrshlsivsqnvhlfddtvynniafgevseeevid
alkranayefvqelsdgintnignngsklsggqrqrisiarallknapvlifdelesltk
scttiviahrlstvenadkivvmdggrvvesgkhqelleqgglytrlyqsglq

SCOPe Domain Coordinates for d5dgxa_:

Click to download the PDB-style file with coordinates for d5dgxa_.
(The format of our PDB-style files is described here.)

Timeline for d5dgxa_: