Lineage for d5bvra2 (5bvr A:121-234)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325260Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2325261Protein automated matches [226856] (4 species)
    not a true protein
  7. 2325350Species Schizosaccharomyces pombe [TaxId:284812] [312738] (1 PDB entry)
  8. 2325352Domain d5bvra2: 5bvr A:121-234 [312740]
    automated match to d1tjta2
    complexed with zn

Details for d5bvra2

PDB Entry: 5bvr (more details), 1.46 Å

PDB Description: actin binding domain of alpha-actinin from schizosaccharomyces pombe
PDB Compounds: (A:) Alpha-actinin-like protein 1

SCOPe Domain Sequences for d5bvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvra2 a.40.1.0 (A:121-234) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
egltakeglllwcqrktanyhpevdvqdftrswtnglafcalihqhrpdlldynkldkkn
hranmqlafdiaqksigiprlievedvcdvdrpdersimtyvaeyfhafstldk

SCOPe Domain Coordinates for d5bvra2:

Click to download the PDB-style file with coordinates for d5bvra2.
(The format of our PDB-style files is described here.)

Timeline for d5bvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bvra1