Class a: All alpha proteins [46456] (289 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (3 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [312738] (1 PDB entry) |
Domain d5bvra2: 5bvr A:121-234 [312740] automated match to d1tjta2 complexed with zn |
PDB Entry: 5bvr (more details), 1.46 Å
SCOPe Domain Sequences for d5bvra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bvra2 a.40.1.0 (A:121-234) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} egltakeglllwcqrktanyhpevdvqdftrswtnglafcalihqhrpdlldynkldkkn hranmqlafdiaqksigiprlievedvcdvdrpdersimtyvaeyfhafstldk
Timeline for d5bvra2: