Class a: All alpha proteins [46456] (289 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
Domain d5a36b2: 5a36 B:149-256 [318725] automated match to d1tjta2 mutant |
PDB Entry: 5a36 (more details), 2 Å
SCOPe Domain Sequences for d5a36b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a36b2 a.40.1.0 (B:149-256) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyrnvniqnfhtswkdglglcalihrhrpdlidysklnkddp igninlameiaekhldipkmldaedivntpkpderaimtyvscfyhaf
Timeline for d5a36b2: