Lineage for d4yuca2 (4yuc A:186-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917582Species Corallococcus coralloides [TaxId:184914] [312199] (3 PDB entries)
  8. 2917584Domain d4yuca2: 4yuc A:186-335 [312201]
    automated match to d4v2pa2
    complexed with mpd, na

Details for d4yuca2

PDB Entry: 4yuc (more details), 1.31 Å

PDB Description: crystal structure of corb derivatized with s-(2-acetamidoethyl) 4- methyl-3-oxohexanethioate
PDB Compounds: (A:) CorB

SCOPe Domain Sequences for d4yuca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yuca2 c.95.1.0 (A:186-335) automated matches {Corallococcus coralloides [TaxId: 184914]}
ihasqvrtygygaefsmvpgggsrrhpngknttpednylhmngaellkigfeylprfnea
lwkqcpditikdcryviphqpsrvvldylsltypddklvriidrfancigasmpmalyea
vkvgglrrgergvltgtgsgvsfvgmvfty

SCOPe Domain Coordinates for d4yuca2:

Click to download the PDB-style file with coordinates for d4yuca2.
(The format of our PDB-style files is described here.)

Timeline for d4yuca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yuca1