Lineage for d4x1ic2 (4x1i C:246-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959964Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)
  8. 2960009Domain d4x1ic2: 4x1i C:246-438 [270817]
    Other proteins in same PDB: d4x1ia1, d4x1ib1, d4x1ic1, d4x1id1, d4x1ie_
    automated match to d4i50a2
    complexed with 3wd, gdp, gtp, loc, mg

Details for d4x1ic2

PDB Entry: 4x1i (more details), 3.11 Å

PDB Description: discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d4x1ic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x1ic2 d.79.2.1 (C:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

SCOPe Domain Coordinates for d4x1ic2:

Click to download the PDB-style file with coordinates for d4x1ic2.
(The format of our PDB-style files is described here.)

Timeline for d4x1ic2: