Lineage for d4oq6b_ (4oq6 B:)
- Root: SCOPe 2.04
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
multi-helical domains of various folds which is thought to unfold in the membraneSuperfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) 
PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domainFamily f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
Pfam PF00452
Protein automated matches [190236] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188722] (34 PDB entries) 
Domain d4oq6b_: 4oq6 B: [237716]
automated match to d3kj0a_
complexed with 2uv
Details for d4oq6b_
PDB Entry: 4oq6 (more details), 1.81 Å
PDB Description: Crystal Structure of Human MCL-1 Bound to Inhibitor 4-hydroxy-4'-propylbiphenyl-3-carboxylic acid
PDB Compounds: (B:) Induced myeloid leukemia cell differentiation protein Mcl-1SCOPe Domain Sequences for d4oq6b_:
Sequence, based on SEQRES records: (download)
>d4oq6b_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqgml
rkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplae
sitdvlvrtkrdwlvkqrgwdgfveffhv
Sequence, based on observed residues (ATOM records): (download)
>d4oq6b_ f.1.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlyrqsleiisrylreqatgakgatsrkaletlrrvgdgvqrnhetafqgmlrkldikne
ddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvr
tkrdwlvkqrgwdgfveffhv
SCOPe Domain Coordinates for d4oq6b_:
Click to download the PDB-style file with coordinates for d4oq6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4oq6b_:
- d4oq6b_ first appeared in SCOPe 2.03
- d4oq6b_ appears in SCOPe 2.05
- d4oq6b_ appears in the current release, SCOPe 2.08, called d4oq6b1
View in 3D
