Lineage for d4o98a_ (4o98 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.0: automated matches [191360] (1 protein)
not a true familyProtein automated matches [190418] (15 species)
not a true protein
Species Pseudomonas oleovorans [TaxId:301] [261363] (1 PDB entry) 
Domain d4o98a_: 4o98 A: [261364]
automated match to d4le6a_
complexed with zn; mutant
Details for d4o98a_
PDB Entry: 4o98 (more details), 2.25 Å
PDB Description: crystal structure of pseudomonas oleovorans pooph mutant h250i/i263w
PDB Compounds: (A:) Organophosphorus hydrolaseSCOPe Domain Sequences for d4o98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o98a_ d.157.1.0 (A:) automated matches {Pseudomonas oleovorans [TaxId: 301]}
apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
cglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmarqavapyakmnkl
kpyktegellpgvslvassghtpghtsylfksggqsllvwgdilinhavqfakpevvwef
dvdsdqarqsrqrilaeaatdklwvagahlpfpglghvreeaqgyawvpvefspirsdrk
laaale
SCOPe Domain Coordinates for d4o98a_:
Click to download the PDB-style file with coordinates for d4o98a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4o98a_:
- d4o98a_ first appeared in SCOPe 2.04
- d4o98a_ is called d4o98a1 in SCOPe 2.06
- d4o98a_ appears in the current release, SCOPe 2.08, called d4o98a1
View in 3D
