Lineage for d4niye_ (4niy E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304874Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 1304875Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 1304876Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)
  6. 1304904Protein automated matches [191287] (2 species)
    not a true protein
  7. 1304905Species Escherichia coli [TaxId:83333] [237072] (1 PDB entry)
  8. 1304906Domain d4niye_: 4niy E: [237073]
    automated match to d1ecya_
    complexed with ca, zn

Details for d4niye_

PDB Entry: 4niy (more details), 2.84 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) complexed to YRH-ecotin (M84Y/M85R/A86H ecotin)
PDB Compounds: (E:) ecotin

SCOPe Domain Sequences for d4niye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4niye_ b.16.1.1 (E:) automated matches {Escherichia coli [TaxId: 83333]}
plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
gwgydyyvfdkvsspvstyrhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr

SCOPe Domain Coordinates for d4niye_:

Click to download the PDB-style file with coordinates for d4niye_.
(The format of our PDB-style files is described here.)

Timeline for d4niye_: