SCOPe 2.03: Domain d4niyf_: 4niy F:

Lineage for d4niyf_ (4niy F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein automated matches [191287] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [237072] (1 PDB entry)

8. Domain d4niyf_: 4niy F: [237074]
   automated match to d1ecya_
   complexed with ca, zn

Details for d4niyf_

PDB Entry: 4niy, 2.84 Å

PDB Description: Crystal structure of trypsiligase (K60E/N143H/Y151H/D189K trypsin) complexed to YRH-ecotin (M84Y/M85R/A86H ecotin)

PDB Compounds: (F:) ecotin

SCOPe Domain Sequences for d4niyf_:

Sequence, based on SEQRES records:

>d4niyf_ b.16.1.1 (F:) automated matches {Escherichia coli [TaxId: 83333]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstyrhcpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d4niyf_ b.16.1.1 (F:) automated matches {Escherichia coli [TaxId: 83333]}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstyrhcpdkkekkfvtaylgdagmlrynsklpivvytpdnvdv
kyrvwkaeekidnavvr

Timeline for d4niyf_:

• d4niyf_ is new in SCOPe 2.03-stable
  
• d4niyf_ appears in SCOPe 2.04
  
• d4niyf_ appears in the current release, SCOPe 2.08