Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (41 species) not a true protein |
Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries) |
Domain d4naua_: 4nau A: [237671] automated match to d4e1aa_ complexed with 2w3, ags |
PDB Entry: 4nau (more details), 2.33 Å
SCOPe Domain Sequences for d4naua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4naua_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]} ehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsvk hlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymms stnysfisssivkevaayradisefvppyvekalkkkfk
Timeline for d4naua_: