Lineage for d4lrsa2 (4lrs A:295-346)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1480920Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1481179Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) (S)
  5. 1481200Family a.5.7.0: automated matches [227294] (1 protein)
    not a true family
  6. 1481201Protein automated matches [227119] (2 species)
    not a true protein
  7. 1481205Species Thermomonospora curvata [TaxId:471852] [227772] (2 PDB entries)
  8. 1481206Domain d4lrsa2: 4lrs A:295-346 [227773]
    Other proteins in same PDB: d4lrsa1
    automated match to d4jn6a2
    complexed with cl, for, gol, mg, nad, peg, pyr, so4

Details for d4lrsa2

PDB Entry: 4lrs (more details), 1.55 Å

PDB Description: Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
PDB Compounds: (A:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4lrsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrsa2 a.5.7.0 (A:295-346) automated matches {Thermomonospora curvata [TaxId: 471852]}
yssfllhaeraaerygvpaheilqrvgeagyvggqedmiidiavqlaeerhg

SCOPe Domain Coordinates for d4lrsa2:

Click to download the PDB-style file with coordinates for d4lrsa2.
(The format of our PDB-style files is described here.)

Timeline for d4lrsa2:

1481206
d4lrsa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4lrsa1