![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (21 species) not a true protein |
![]() | Species Lobophyllia hemprichii [TaxId:46758] [187486] (21 PDB entries) |
![]() | Domain d4ljdd_: 4ljd D: [228235] Other proteins in same PDB: d4ljdc2 automated match to d2vvhc_ complexed with so3, so4 |
PDB Entry: 4ljd (more details), 2.5 Å
SCOPe Domain Sequences for d4ljdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ljdd_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]} msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
Timeline for d4ljdd_:
![]() Domains from other chains: (mouse over for more information) d4ljda_, d4ljdb_, d4ljdc1, d4ljdc2 |