Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d4lgrb_: 4lgr B: [331066] Other proteins in same PDB: d4lgra_ automated match to d1igmh_ complexed with acy, cl, edo, zn |
PDB Entry: 4lgr (more details), 1.65 Å
SCOPe Domain Sequences for d4lgrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lgrb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]} vqlvesggglvqpggslrlhcaasgsiasiyrtcwyrqgtgkqrelvaaitsggntyyad svkgrftisrdnakntidlqmnslkpedtavyycnadeagiggfndywgqgtqvtvssah hs
Timeline for d4lgrb_: