Lineage for d4kqoa2 (4kqo A:222-562)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245712Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196777] (16 PDB entries)
  8. 2245729Domain d4kqoa2: 4kqo A:222-562 [228778]
    Other proteins in same PDB: d4kqoa1, d4kqob1
    automated match to d3equa2
    complexed with cl, gol, imd, jpp

Details for d4kqoa2

PDB Entry: 4kqo (more details), 2.31 Å

PDB Description: Crystal structure of penicillin-binding protein 3 from pseudomonas aeruginosa in complex with piperacillin
PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d4kqoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kqoa2 e.3.1.0 (A:222-562) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
sidlrlqylahrelrnallengakagslvimdvktgeilamtnqptynpnnrrnlqpaam
rnramidvfepgstvkpfsmsaalasgrwkpsdivdvypgtlqigrytirdvsrnsrqld
ltgilikssnvgiskiafdigaesiysvmqqvglgqdtglgfpgervgnlpnhrkwpkae
tatlaygyglsvtaiqlahayaalandgksvplsmtrvdrvpdgvqvispevastvqgml
qqvveaqggvfraqvpgyhaagksgtarkvsvgtkgyrenayrslfagfapatdpriamv
vvidepskagyfgglvsapvfskvmagalrlmnvppdnlpt

SCOPe Domain Coordinates for d4kqoa2:

Click to download the PDB-style file with coordinates for d4kqoa2.
(The format of our PDB-style files is described here.)

Timeline for d4kqoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kqoa1