Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) |
Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins) |
Protein automated matches [190109] (8 species) not a true protein |
Species Desulfomicrobium baculatum [TaxId:525897] [226721] (6 PDB entries) |
Domain d4kl8l_: 4kl8 L: [224351] Other proteins in same PDB: d4kl8s_, d4kl8t_ automated match to d1cc1l_ complexed with ca, cl, fco, gol, h2s, ni, sf4 |
PDB Entry: 4kl8 (more details), 1.52 Å
SCOPe Domain Sequences for d4kl8l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kl8l_ e.18.1.1 (L:) automated matches {Desulfomicrobium baculatum [TaxId: 525897]} gkvkisidpltrveghlkievevkdgkvvdakcsggmfrgfeqilrgrdprdssqivqri cgvcptahctasvmaqddafgvkvttngritrnlifganylqshilhfyhlaaldyvkgp dvspfvpryanadlltdrikdgakadatntyglnqylkaleirrichemvamfggrmphv qgmvvggateiptadkvaeyaarfkevqkfvieeylpliytlgsvytdlfetgigwknvi afgvfpedddyktfllkpgvyidgkdeefdsklvkeyvghsffdhsapgglhysvgetnp npdkpgaysfvkaprykdkpcevgplarmwvqnpelspvgqkllkelygieaknfrdlgd kafsimgrhvaraeetwltavavekwlkqvqpgaetyvkseipdaaegtgfteaprgall hylkikdkkienyqivsatlwnanprddmgqrgpieealigvpvpdiknpvnvgrlvrsy dpxlgcavh
Timeline for d4kl8l_: