Lineage for d4k4ta_ (4k4t A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1952391Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 1952692Protein automated matches [190260] (26 species)
    not a true protein
  7. 1952887Species Human poliovirus 1 [TaxId:12081] [193135] (16 PDB entries)
  8. 1952901Domain d4k4ta_: 4k4t A: [193136]
    automated match to d1ra6a_
    protein/RNA complex; complexed with gol, zn

Details for d4k4ta_

PDB Entry: 4k4t (more details), 2.75 Å

PDB Description: Poliovirus polymerase elongation complex (r4_form)
PDB Compounds: (A:) RNA-directed RNA polymerase 3D-POL

SCOPe Domain Sequences for d4k4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ta_ e.8.1.4 (A:) automated matches {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlyrrwldsfg

SCOPe Domain Coordinates for d4k4ta_:

Click to download the PDB-style file with coordinates for d4k4ta_.
(The format of our PDB-style files is described here.)

Timeline for d4k4ta_: