Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.6: PdxS-like [141755] (2 proteins) Pfam PF01680; SOR/SNZ |
Protein automated matches [193117] (4 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [193118] (1 PDB entry) |
Domain d4jdyc_: 4jdy C: [193119] automated match to d1znna1 complexed with gol |
PDB Entry: 4jdy (more details), 1.8 Å
SCOPe Domain Sequences for d4jdyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jdyc_ c.1.2.6 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} tarvkrgmaemlkggvimdvvtpeqariaegagavavmalervpadiraqggvsrmsdpd miegiiaavtipvmakvrighfveaqilqtlgvdyidesevltpadyahhidkwnftvpf vcgatnlgealrrisegaamirskgeagtgdvsnatthmraiggeirrltsmsedelfva akelqapyelvaevaragklpvtlftaggiatpadaammmqlgaegvfvgsgifksgape hraaaivkattffddpdvlakvsr
Timeline for d4jdyc_: