Lineage for d4iyja_ (4iyj A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) 
Family c.23.10.0: automated matches [191588] (1 protein)
not a true familyProtein automated matches [191059] (16 species)
not a true protein
Species Bacteroides uniformis [TaxId:411479] [226611] (1 PDB entry) 
Domain d4iyja_: 4iyj A: [223479]
automated match to d1yzfa1
complexed with cl, gol, unl
Details for d4iyja_
PDB Entry: 4iyj (more details), 1.37 Å
PDB Description: crystal structure of a putative acylhydrolase (bacuni_03406) from bacteroides uniformis atcc 8492 at 1.37 a resolution
PDB Compounds: (A:) GDSL-like proteinSCOPe Domain Sequences for d4iyja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iyja_ c.23.10.0 (A:) automated matches {Bacteroides uniformis [TaxId: 411479]}
sdaqkqdwgnlkryaeankelvrkgkqkdrvvfmgnsitegwvandaaffedngyvgrgi
ggqtsshfllrfredviklapalvvinagtndiaenagayneeytfgnivsmvelarank
ikviltsvlpaaafgwnpsvkdapqkimqlnarirkyaqenkipyvdyysemvegdnkal
nssytrdgvhptlegykvmealikkaidkvl
SCOPe Domain Coordinates for d4iyja_:
Click to download the PDB-style file with coordinates for d4iyja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4iyja_:
- d4iyja_ first appeared in SCOPe 2.03
- d4iyja_ appears in SCOPe 2.07
View in 3D
