Lineage for d4isxa_ (4isx A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
superhelix turns are made of parallel beta-strands and (short) turnsSuperfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) 
superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strandsFamily b.81.1.0: automated matches [191560] (1 protein)
not a true familyProtein automated matches [190967] (28 species)
not a true protein
Species Clostridium difficile [TaxId:272563] [193268] (3 PDB entries) 
Domain d4isxa_: 4isx A: [193269]
automated match to d2p2oa_
complexed with aco, mes
Details for d4isxa_
PDB Entry: 4isx (more details), 2.7 Å
PDB Description: The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
PDB Compounds: (A:) maltose o-acetyltransferaseSCOPe Domain Sequences for d4isxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4isxa_ b.81.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
amtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkq
inveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaql
rnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrv
ikkiee
SCOPe Domain Coordinates for d4isxa_:
Click to download the PDB-style file with coordinates for d4isxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4isxa_:
- d4isxa_ first appeared in SCOPe 2.02
- d4isxa_ appears in SCOPe 2.04
- d4isxa_ is called d4isxa1 in SCOPe 2.06
- d4isxa_ appears in the current release, SCOPe 2.08, called d4isxa1
View in 3D
