Lineage for d4hy4b_ (4hy4 B:)
- Root: SCOPe 2.05
Class g: Small proteins [56992] (92 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
metal(zinc)-bound alpha+beta foldSuperfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) Protein automated matches [190700] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187840] (35 PDB entries) 
Domain d4hy4b_: 4hy4 B: [222791]
automated match to d3mupc_
complexed with 1bg, zn
Details for d4hy4b_
PDB Entry: 4hy4 (more details), 1.25 Å
PDB Description: crystal structure of ciap1 bir3 bound to t3170284
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2SCOPe Domain Sequences for d4hy4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hy4b_ g.52.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwe
sgddpwvehakwfprceflirmkgqefvdeiqgry
SCOPe Domain Coordinates for d4hy4b_:
Click to download the PDB-style file with coordinates for d4hy4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hy4b_:
- d4hy4b_ first appeared in SCOPe 2.03
- d4hy4b_ appears in SCOPe 2.04
- d4hy4b_ is called d4hy4b1 in SCOPe 2.06
- d4hy4b_ appears in the current release, SCOPe 2.08, called d4hy4b1
View in 3D
