Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [234685] (1 PDB entry) |
Domain d4hoja2: 4hoj A:79-201 [234686] Other proteins in same PDB: d4hoja1 automated match to d3fhsa2 complexed with act, ca, gsh |
PDB Entry: 4hoj (more details), 1.4 Å
SCOPe Domain Sequences for d4hoja2:
Sequence, based on SEQRES records: (download)
>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]} lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspsfsk skyilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaeka mrk
>d4hoja2 a.45.1.0 (A:79-201) automated matches {Neisseria gonorrhoeae [TaxId: 485]} lmpgdpvmrgrgrlvlyrmekelfnhvqvlenpaaankeqakareaigngltmlspssky ilgedfsmidvalapllwrldhydvklgksaapllkyaerifqreafiealtpaekamrk
Timeline for d4hoja2: